PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G07230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 247aa    MW: 26664 Da    PI: 6.9419
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G07230.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.89.3e-1969122356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      k++++++eq + Le  F+k+r++ + ++ +LA++lgL+ +qV vWFqNrRa++k
  OGLUM03G07230.1  69 KKRRLSDEQARFLEMSFKKERKLETPRKVQLAAELGLDAKQVAVWFQNRRARHK 122
                      56689***********************************************99 PP

2HD-ZIP_I/II113.61.3e-3669159292
      HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                      kkrrls+eq+++LE+sF++e+kLe+ rKv+la eLgl+++qvavWFqnrRAR+k+k +E+++++L++a+da++ +n++Le+e  +L+e+l+
  OGLUM03G07230.1  69 KKRRLSDEQARFLEMSFKKERKLETPRKVQLAAELGLDAKQVAVWFQNRRARHKSKLMEEEFAKLRSAHDAVVLQNCHLETELLKLKERLA 159
                      9**************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.17E-1762123IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-1763123IPR009057Homeodomain-like
PROSITE profilePS5007116.82764124IPR001356Homeobox domain
SMARTSM003891.6E-1667128IPR001356Homeobox domain
CDDcd000867.97E-1669124No hitNo description
PfamPF000462.9E-1669122IPR001356Homeobox domain
PRINTSPR000315.6E-695104IPR000047Helix-turn-helix motif
PROSITE patternPS00027099122IPR017970Homeobox, conserved site
PRINTSPR000315.6E-6104120IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MSREEDEKLL FPSFAFPAEC FPEAATSGGE QKKARQRRRR KVKPEAAAAA AAAAAAALAG  60
ESGGDEQAKK RRLSDEQARF LEMSFKKERK LETPRKVQLA AELGLDAKQV AVWFQNRRAR  120
HKSKLMEEEF AKLRSAHDAV VLQNCHLETE LLKLKERLAD VEEEKAKLAA VAAATTGGGG  180
GGGGGSSSPS SSSFSTVTYH PALAGQFGVE AVAEEADLTY MSEYAYNSYM LELAAAGYCG  240
GVYDQFS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1175185TGGGGGGGGGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0734460.0AK073446.1 Oryza sativa Japonica Group cDNA clone:J033043C24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629042.11e-131PREDICTED: homeobox-leucine zipper protein HOX12
SwissprotQ10QF21e-133HOX12_ORYSJ; Homeobox-leucine zipper protein HOX12
TrEMBLA0A0D9Z3F91e-178A0A0D9Z3F9_9ORYZ; Uncharacterized protein
STRINGLOC_Os03g10210.11e-131(Oryza sativa Japonica Group)
STRINGORGLA03G0069400.11e-131(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP200638101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.11e-29homeobox protein 40